General Information

  • ID:  hor000582
  • Uniprot ID:  P85797
  • Protein name:  Allatostatin-6
  • Gene name:  NA
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GRQPYSFGL
  • Length:  9(146-154)
  • Propeptide:  MRSRTSVLTSSLAFLYFFGIVGRSALAMEETPASSMNLQHYNNMLNPMVFDDTMPEKRAYTYVSEYKRLPVYNFGIGKRWIDTNDNKRGRDYSFGLGKRRQYSFGLGKRNDNADYPLRLNLDYLPVDNPAFHSQENTDDFLEEKRGRQPYSFGLGKRAVHYSGGQPLGSKRPNDMLSQRYHFGLGKRMSEDEEESSQ
  • Signal peptide:  MRSRTSVLTSSLAFLYFFGIVGRSALA
  • Modification:  T9 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptides.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P85797-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000582_AF2.pdbhor000582_ESM.pdb

Physical Information

Mass: 116701 Formula: C47H69N13O13
Absent amino acids: ACDEHIKMNTVW Common amino acids: G
pI: 9.35 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -65.56 Boman Index: -1422
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 43.33
Instability Index: 5168.89 Extinction Coefficient cystines: 1490
Absorbance 280nm: 186.25

Literature

  • PubMed ID:  17068263
  • Title:  From the Genome to the Proteome: Uncovering Peptides in the Apis Brain